4.70 Rating by CuteStat

This website is a sub-domain of archnadzor.ru. It has a global traffic rank of #1528852 in the world. This website is estimated worth of $ 720.00 and have a daily income of around $ 3.00. As no active threats were reported recently by users, redbook.archnadzor.ru is SAFE to browse.

PageSpeed Score
88
Siteadvisor Rating
No Risk Issues

Traffic Report

Daily Unique Visitors: 551
Daily Pageviews: 1,102

Estimated Valuation

Income Per Day: $ 3.00
Estimated Worth: $ 720.00

Search Engine Indexes

Google Indexed Pages: Not Applicable
Bing Indexed Pages: Not Applicable

Search Engine Backlinks

Google Backlinks: 393
Bing Backlinks: Not Applicable

Safety Information

Google Safe Browsing: No Risk Issues
Siteadvisor Rating: No Risk Issues
WOT Trustworthiness: Not Applicable
WOT Child Safety: Not Applicable

Website Ranks & Scores

Alexa Rank: 1,528,852
Domain Authority: Not Applicable

Web Server Information

Hosted IP Address:

104.28.1.119

Hosted Country:

United States of America US

Location Latitude:

37.751

Location Longitude:

-97.822

Page Resources Breakdown

Homepage Links Analysis

Website Inpage Analysis

H1 Headings: 2 H2 Headings: 1
H3 Headings: 2 H4 Headings: 4
H5 Headings: 1 H6 Headings: Not Applicable
Total IFRAMEs: Not Applicable Total Images: 4
Google Adsense: Not Applicable Google Analytics: Not Applicable

Websites Hosted on Same IP (i.e. 104.28.1.119)

Архнадзор

- archnadzor.ru
1,417,629 $ 960.00

www.mcentre.lk, a fully owned e-commerce portal by Metropolitan comput

- mcentre.lk

Sri Lanka’s leading online shop for Acer, Canon, HP, Dell & Many more IT Products. Buy online from mcentre.lk and get special discounts.

399,916 $ 22,140.00

BibleCodeWisdom - Situs Judi Online Terpercaya

- biblecodewisdom.com

BibleCodeWisdom.com merupakan website Judi Online yang aman dan belum pernah mengecewakan member nya sama sekali di tambah lagi bonus nya yang menarik yang membuat member nya nyaman bermain

Not Applicable $ 8.95

Hallo Region - Travel and Business

- halloregion.com
Not Applicable $ 8.95

Nigar Camal

- nigarjamal.com

Eurovision Winner of Azerbaijan

Not Applicable $ 8.95

HTTP Header Analysis

HTTP/1.1 200 OK
Date: Mon, 06 Jan 2020 18:47:55 GMT
Content-Type: text/html; charset=UTF-8
Transfer-Encoding: chunked
Connection: keep-alive
X-Powered-By: PHP/5.6.7
Cache-Control: private, must-revalidate
Expires: Mon, 06 Jan 2020 19:46:36 GMT
CF-Cache-Status: DYNAMIC
Expect-CT: max-age=604800, report-uri="https://report-uri.cloudflare.com/cdn-cgi/beacon/expect-ct"
Server: cloudflare
CF-RAY: 550fdcfa6dcb51bc-SJC
Content-Encoding: gzip

DNS Record Analysis

Host Type TTL Extra
redbook.archnadzor.ru A 299 IP: 104.28.0.119
redbook.archnadzor.ru A 299 IP: 104.28.1.119
redbook.archnadzor.ru TXT 300 TXT: google-site-verification=MoFn_vKuQXKPEUK
8-Rn3fNw0ChL9TO32WZWipUDKVkg
redbook.archnadzor.ru AAAA 300 IPV6: 2606:4700:30::681c:177
redbook.archnadzor.ru AAAA 300 IPV6: 2606:4700:30::681c:77

Similarly Ranked Websites

Index of /

- onlinemarketingreviewsandtips.com
1,528,854 $ 480.00

BoyneRewards

- boynerewards.com
1,528,854 $ 720.00

Home - Dark Knight News

- darkknightnews.com

The Dark Knight news is a fan based site dedicated to the iconic DC hero, Batman. Get the latest Batman news, Batman comic news & Dark Knight movie news!

1,528,855 $ 720.00

KiatNews.ID | Tajam Mengulas Fakta

- kiatnews.id

Tajam Mengulas Fakta

1,528,855 $ 960.00

Darshana Industries Pvt. Ltd. Pune

- darshanaindustries.com

Darshana Industries Pvt. Ltd.

1,528,856 $ 720.00